Go to browser
virulence, detoxification, adaptation
lipid metabolism
conserved hypotheticals
pseudogenes
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
General annotation
TypeCDS
FunctionConverts amides such as nicotinamide to corresponding acid.
ProductPyrazinamidase/nicotinamidase PncA (PZase)
CommentsRv2043c, (MTV018.30c), len: 186 aa. PncA, pyrazinamidase/nicotinamidase (see citations below), involved in susceptibility or resistance to antituberculous drug pyrazinamide. Rv2043c, (MTV018.30c), len: 186 aa. PncA, pyrazinamidase/nicotinamidase (see citations below), involved in susceptibility or resistance to antituberculous drug pyrazinamide.
Functional categoryIntermediary metabolism and respiration
Proteomics
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS22886812289241-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
      
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2043c|pncA
MRALIIVDVQNDFCEGGSLAVTGGAALARAISDYLAEAADYHHVVATKDFHIDPGDHFSGTPDYSSSWPPHCVSGTPGADFHPSLDTSAIEAVFYKGAYTGAYSGFEGVDENGTPLLNWLRQRGVDEVDVVGIATDHCVRQTAEDAVRNGLATRVLVDLTAGVSADTTVAALEEMRTASVELVCSS
      
Bibliography