Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductAcid and phagosome regulated protein A AprA
CommentsRv2395A, len: 71 aa. AprA, acid and phagosome regulated protein A, restricted to M. tuberculosis complex. Note completely overlapped by sRNA mcr7. Rv2395A, len: 71 aa. AprA, acid and phagosome regulated protein A, restricted to M. tuberculosis complex. Note completely overlapped by sRNA mcr7.
Functional categoryConserved hypotheticals
Proteomics
MutationDisruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS26922242692439+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
      
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2395A|aprA
LTMTASVAKVTAARPEPSAAWAEARRRVRQRREDMLRHPAFLSKQLPAEPADDDGVAAVYDIAIARRRRPA