Go to browser
virulence, detoxification, adaptation
lipid metabolism
conserved hypotheticals
pseudogenes
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
General annotation
TypeCDS
FunctionInvolved in deoxyribonucleotide biosynthesis. Provides the sole de novo source of dTMP for DANA biosynthesis [catalytic activity: 5,10-methylenetetrahydrofolate + dUMP = dihydrofolate + dTMP].
ProductProbable thymidylate synthase ThyA (ts) (TSASE)
CommentsRv2764c, (MTV002.29c), len: 263 aa. Probable thyA, thymidylate synthase, equivalent to Q9CBW0|TYSY_MYCLE|THYA|ML1519 thymidylate synthase from Mycobacterium leprae (266 aa), FASTA scores: opt: 1602, E(): 5.9e-102, (85.5% identity in 262 aa overlap). Also highly similar to many e.g. P00470|TYSY_ECOLI|B2827|Z4144|ECS3684|BAB37107|AAG57938 from Escherichia coli strains K12 and O157:H7 (264 aa), FASTA scores: opt: 1309, E(): 5.9e-82, (66.65% identity in 261 aa overlap); P48464|TYSY_SHIFL|THYA from Shigella flexneri (264 aa), FASTA scores: opt: 1303, E(): 1.5e-81, (65.9% identity in 261 aa overlap); P54081|TYSB_BACAM|THYB|THYBA from Bacillus amyloliquefaciens (264 aa), FASTA scores: opt: 1235, E(): 6.7e-77, (66.65% identity in 261 aa overlap); etc. Contains PS00091 Thymidylate synthase active site. Belongs to the thymidylate synthase family. Rv2764c, (MTV002.29c), len: 263 aa. Probable thyA, thymidylate synthase, equivalent to Q9CBW0|TYSY_MYCLE|THYA|ML1519 thymidylate synthase from Mycobacterium leprae (266 aa), FASTA scores: opt: 1602, E(): 5.9e-102, (85.5% identity in 262 aa overlap). Also highly similar to many e.g. P00470|TYSY_ECOLI|B2827|Z4144|ECS3684|BAB37107|AAG57938 from Escherichia coli strains K12 and O157:H7 (264 aa), FASTA scores: opt: 1309, E(): 5.9e-82, (66.65% identity in 261 aa overlap); P48464|TYSY_SHIFL|THYA from Shigella flexneri (264 aa), FASTA scores: opt: 1303, E(): 1.5e-81, (65.9% identity in 261 aa overlap); P54081|TYSB_BACAM|THYB|THYBA from Bacillus amyloliquefaciens (264 aa), FASTA scores: opt: 1235, E(): 6.7e-77, (66.65% identity in 261 aa overlap); etc. Contains PS00091 Thymidylate synthase active site. Belongs to the thymidylate synthase family.
Functional categoryIntermediary metabolism and respiration
Proteomics
MutationEssential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS30736803074471-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
      
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2764c|thyA
VTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFEYTYEDIVVKNYDPHPAIKAPVAV