Go to browser
virulence, detoxification, adaptation
lipid metabolism
conserved hypotheticals
pseudogenes
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
General annotation
TypeCDS
FunctionCould have a role in acetylating, and hence inactivating, the antitubercular drug isoniazid [catalytic activity: acetyl-CoA + arylamine = CoA + N-acetylarylamine].
ProductArylamine N-acetyltransferase Nat (arylamine acetylase)
CommentsRv3566c, (MT3671, MTCY06G11.13c), len: 283 aa. Nat (alternate gene name: nhoA), arylamine N-acetyltransferase (see citations below), highly similar to O86309|NAT_MYCSM arylamine N-acetyltransferase from Mycobacterium smegmatis (see citation below) (275 aa), FASTA scores: opt: 1114, E(): 3e-66, (60.95% identity in 274 aa overlap). Also highly similar to others e.g. Q98D42|BAB51429|MLR4870 from Rhizobium loti (Mesorhizobium loti) (278 aa), FASTA scores: opt: 697, E(): 1.1e-38, (44.1% identity in 272 aa overlap); P77567|NHOA_ECOLI|B1463 from Escherichia coli strain K12 (281 aa), FASTA scores: opt: 537, E(): 4.4e-28, (38.85% identity in 273 aa overlap); Q00267|NHOA_SALTY from Salmonella typhimurium (281 aa), FASTA scores: opt: 507, E(): 4.3e-26, (34.8% identity in 273 aa overlap); etc. Belongs to the arylamine N-acetyltransferase family. Note that previously known as nhoA (332 aa) and that nucleotide 4007874 has been changed since first submission (G deleted). Rv3566c, (MT3671, MTCY06G11.13c), len: 283 aa. Nat (alternate gene name: nhoA), arylamine N-acetyltransferase (see citations below), highly similar to O86309|NAT_MYCSM arylamine N-acetyltransferase from Mycobacterium smegmatis (see citation below) (275 aa), FASTA scores: opt: 1114, E(): 3e-66, (60.95% identity in 274 aa overlap). Also highly similar to others e.g. Q98D42|BAB51429|MLR4870 from Rhizobium loti (Mesorhizobium loti) (278 aa), FASTA scores: opt: 697, E(): 1.1e-38, (44.1% identity in 272 aa overlap); P77567|NHOA_ECOLI|B1463 from Escherichia coli strain K12 (281 aa), FASTA scores: opt: 537, E(): 4.4e-28, (38.85% identity in 273 aa overlap); Q00267|NHOA_SALTY from Salmonella typhimurium (281 aa), FASTA scores: opt: 507, E(): 4.3e-26, (34.8% identity in 273 aa overlap); etc. Belongs to the arylamine N-acetyltransferase family. Note that previously known as nhoA (332 aa) and that nucleotide 4007874 has been changed since first submission (G deleted).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutationNon-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Deletion of nat from M. bovis BCG Pasteur reduces biosynthesis of mycolic acids and other complex lipids (See Bhakta et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40073314008182-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
      
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3566c|nat
MALDLTAYFDRINYRGATDPTLDVLQDLVTVHSRTIPFENLDPLLGVPVDDLSPQALADKLVLRRRGGYCFEHNGLMGYVLAELGYRVRRFAARVVWKLAPDAPLPPQTHTLLGVTFPGSGGCYLVDVGFGGQTPTSPLRLETGAVQPTTHEPYRLEDRVDGFVLQAMVRDTWQTLYEFTTQTRPQIDLKVASWYASTHPASKFVTGLTAAVITDDARWNLSGRDLAVHRAGGTEKIRLADAAAVVDTLSERFGINVADIGERGALETRIDELLARQPGADAP
      
Bibliography