Gene ML0013c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved transmembrane protein |
| Comments | ML0013c, len: 93 aa. Probable conserved transmembrane protein, similar to Rv0011c|Y011_MYCTU|P71581 probable conserved transmembrane protein from M. tuberculosis (93 aa), Fasta scores: E(): 0, (89.2% identity in 93 aa overlap); also similar to Q8NU99 Cgl0040 hypothetical membrane protein from Corynebacterium glutamicum (90 aa), E(): 0, (40.0% identity in 95 aa overlap). Contains hydrophobic, possible membrane-spanning regions. |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 17134 | 17415 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0013c|ML0013c
MPKSKVRKKNDFTITSVSRTPVKVKVGPSSVWFVTLFVGLMLIGLVWLMVFQLAALGTQAPTALHWMAQLGPWNYAIAFAFMITGLLLTMRWH
Bibliography
No article yet recorded