Gene ML0021c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0021c, len: 155 aa. Conserved hypothetical protein, highly similar to Rv0019c|P71589 hypothetical protein from M. tuberculosis (155 aa), fasta scores: E(): 1.8e-59, (90.968% identity in 155 aa overlap); and similar to Q9XA20|AL079308 hypothetical protein SCH69.14 from Streptomyces coelicolor (172 aa), Fasta scores: E(): 2e-21, (44.4% identity in 171 aa overlap). Similar at the C-terminus to ML2076. Previously sequenced as Q50189|Z70722 (155 aa), Fasta scores: E(): 0, (100.0% identity in 155 aa overlap). Contains Pfam match to entry PF00498 FHA, FHA domain. |
| Functional category | Conserved hypotheticals, Regulatory proteins |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 26584 | 27051 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0021c|ML0021c
MQGLVLQLARAGFLMLLWVFIWSVLQILKTDIYAPTGAVMVRRSLTLRNTLLLSRQRRHAARYLMVTEGSLTGARITLSGQPVLIGRADDSTLVLTDDYASNRHARLSQRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPLGTPVRIGKTAIELRP
Bibliography
No article yet recorded