Gene ML0021c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Conserved hypothetical protein |
Comments | ML0021c, len: 155 aa. Conserved hypothetical protein, highly similar to Rv0019c|P71589 hypothetical protein from M. tuberculosis (155 aa), fasta scores: E(): 1.8e-59, (90.968% identity in 155 aa overlap); and similar to Q9XA20|AL079308 hypothetical protein SCH69.14 from Streptomyces coelicolor (172 aa), Fasta scores: E(): 2e-21, (44.4% identity in 171 aa overlap). Similar at the C-terminus to ML2076. Previously sequenced as Q50189|Z70722 (155 aa), Fasta scores: E(): 0, (100.0% identity in 155 aa overlap). Contains Pfam match to entry PF00498 FHA, FHA domain. |
Functional category | Conserved hypotheticals, Regulatory proteins |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 26584 | 27051 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0021c|ML0021c MQGLVLQLARAGFLMLLWVFIWSVLQILKTDIYAPTGAVMVRRSLTLRNTLLLSRQRRHAARYLMVTEGSLTGARITLSGQPVLIGRADDSTLVLTDDYASNRHARLSQRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPLGTPVRIGKTAIELRP
Bibliography
No article yet recorded