Gene ML0028
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0028, len: 201 aa. Conserved hypothetical protein, highly similar to Rv0038|P71608|AL123456 hypothetical protein from M. tuberculosis (202 aa), Fasta scores: E(): 0, (88.1% identity in 202 aa overlap). Similar to CAB72194|AL138851 hypothetical protein SCE59.07C from Streptomyces coelicolor (193 aa), Fasta scores: E(): 3.5e-28, (45.6% identity in 182 aa overlap) and shows weak similarity to many other bacterial hypothetical proteins. Previously sequenced as Q50191|Z70722 (202 aa), Fasta scores: E(): 0, (100.0% identity in 201 aa overlap). |
| Functional category | Conserved hypotheticals |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 33100 | 33705 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0028|ML0028
VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGTLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIGADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLKGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSRN
Bibliography
No article yet recorded