Gene ML0030c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved transmembrane protein |
| Comments | ML0030c, len: 113 aa. Possible conserved transmembrane protein, highly similar to Rv0039c|P71696|AL123456 possible conserved transmembrane protein from M. tuberculosis (115 aa), Fasta scores: E(): 2.2e-25, (63.2% identity in 114 aa overlap). Previously sequenced as O32871|Z70722 (113 aa), Fasta scores: E(): 0, (100.0% identity in 113 aa overlap). Contains hydrophobic, possible membrane-spanning regions. |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 34750 | 35091 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0030c|ML0030c
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIMLAAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATSCGKNCAGCILSCR
Bibliography
No article yet recorded