Gene ML0049c (esat-6)
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable 6 kDa early secretory antigenic target homolog EsxA (ESAT-6-like protein) (L-ESAT) |
Comments | ML0049c, len: 95 aa. Probable esxA, 6 KDa early secretory antigenic target homolog (see citations below). Similar to Rv3875|ESA6_MYCTU|Q57165 esxA, early secretory antigenic target from M. tuberculosis (94 aa), Fasta scores: E(): 4.2e-10, (36.3% identity in 91 aa overlap). Also shows weak similarity to others e.g. CFP7_MYCTU|O53693 esxH, 10 KDa antigen from M. tuberculosis (95 aa), Fasta scores: E(): 0.17, (25.6% identity in 78 aa overlap). Other members of this family include ML0363. Previously sequenced as ESA6_MYCLE|Q50206 (95 aa), Fasta scores: E(): 0, (100.0% identity in 95 aa overlap). Belongs to the ESAT6 family. Note that previously known as esat-6. |
Functional category | Cell wall and cell processes |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 61406 | 61693 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0049c|esxA MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESYSSVQRRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVMSMFTG
Bibliography
No article yet recorded