Gene ML0050c (lhp)
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible 10 KDA culture filtrate antigen homolog EsxB (lhp) (cfp10) |
| Comments | ML0050c, len: 100 aa. Possible esxB, 10 KDA culture filtrate antigen homolog (see citations below). Similar to Rv3874|O69739|AF004671 esxB, culture filtrate protein 10 kDa CFP-10 from M. tuberculosis (100 aa), Fasta scores: E(): 1.8e-10, (40.0% identity in 100 aa overlap). Also shows weak similarity to others M. tuberculosis proteins e.g. Rv1197|O05299|AL123456 hypothetical protein (98 aa), Fasta scores: E(): 0.061, (21.9% identity in 96 aa overlap), and Rv1038c|P96363|AL123456 hypothetical protein (98 aa), Fasta scores: E(): 0.084, (21.9% identity in 96 aa overlap). These and others form a protein family typically found downstream of a member of the ESAT6 family. Previously sequenced as O33084|Y14967 (100 aa), Fasta scores: E(): 0, (100.0% identity in 100 aa overlap). Belongs to the ESAT6 family. |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 61720 | 62022 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0050c|esxB
MAEMITEAAILTQQAAQFDQIASGLSQERNFVDSIGQSFQNTWEGQAASAALGALGRFDEAMQDQIRQLESIVDKLNRSGGNYTKTDDEANQLLSSKMNF
Bibliography
No article yet recorded