Gene ML0062
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable NADH-dependent glutamate synthase (small subunit) GltD (L-glutamate synthase) (L-glutamate synthetase) (NADH-glutamate synthase) (NADH-GOGAT) |
| Comments | ML0062, len: 488 aa. Probable gltD, small subunit of NADH-dependent glutamate synthase (EC 1.4.1.13), highly similar to Rv3858c|P96219|Al123456 gltD, probable NADH-dependent glutamate synthase small subunit from M. tuberculosis (488 aa), Fasta scores: E(): 0, (87.7% identity in 488 aa overlap); and similar to many other putative glutamate synthase small subunits e.g. GLTD_ECOLI|P09832 gltD, glutamate synthase [NADPH] small chain from Escherichia coli (471 aa), Fasta scores: E(): 0, (37.8% identity in 474 aa overlap). Contains Pfam match to entry PF00070 pyr_redox, Pyridine nucleotide-disulphide oxidoreductase. |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 82285 | 83751 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0062|gltD
MADPAGFLKYTQRELPRRRPVPLRLRDWKELYEEFDKETLRNQASRCMDCGIPFCHNGCPLGNLIPEWNDLVRRGRWHDAVERLHATNNFPDVTGRLCPAPCESACVLGINQDPVTIKQIELEIIDKAFDEGWVQPLPPQQLTGKTVAVVGSGPAGLAAAQQLTRAGHRVTVFERDDRIGGLLRYGIPEFKMEKRFLERRLDQLRAEGTEFRSGVNVGVDITADQLCADFDAVVLAGGAATWRELPIPGRELDGVHQAMEFLPWVNRVQEGDDVLGDDGQPPITAKDKKVVIIGGGDTGADCLGAVHRQGAIHVHQLEIMPRPPDARAASTPWPTYPLMYRVSPAHEEGGERVFSVNTEEFVGKNGRVHALKAHEVTMQDGRFVKVENSVFELEADLVLLAMGFVGPEKPGLLTDLGVKFTDRGNVARGADFDTSVPGVFVAGDMGRGQSLIVWAIAEGRAAAAAVDRFLMGATALPAPVKPSSLPLQ
Bibliography
No article yet recorded
