Gene ML0071c 
in Mycobacterium leprae TN
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Conserved hypothetical protein | 
| Comments | ML0071c, len: 177 aa. Conserved hypothetical protein, equivalent to Rv3847|P96230|AL123456) hypothetical protein from M. tuberculosis (177 aa), Fasta scores: E(): 0, (96.6% identity in 177 aa overlap); and Q9F9R0 HYPOTHETICAL 18.5 KDA PROTEIN from Mycobacterium paratuberculosis (177 aa). | 
| Functional category | Conserved hypotheticals | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 91913 | 92446 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium leprae TN|ML0071c|ML0071c
METGSGLPIGVVPFHARGALKGFVISGRWPDSTKEWAQLLMVAVRIASLPGLLSTTTVFGAREELPDEPEPGTVGLVLAEGTVFGESAIQPGYFADHQPPALLMLHPPSETMPSLPECTGAASGCVLLPGLPYLGLEHRAAWVEAEADGTITSMVSRVGVDPISHPDTAILAMLLAA
      
    Bibliography
    No article yet recorded