Gene ML0071c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0071c, len: 177 aa. Conserved hypothetical protein, equivalent to Rv3847|P96230|AL123456) hypothetical protein from M. tuberculosis (177 aa), Fasta scores: E(): 0, (96.6% identity in 177 aa overlap); and Q9F9R0 HYPOTHETICAL 18.5 KDA PROTEIN from Mycobacterium paratuberculosis (177 aa). |
| Functional category | Conserved hypotheticals |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 91913 | 92446 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0071c|ML0071c
METGSGLPIGVVPFHARGALKGFVISGRWPDSTKEWAQLLMVAVRIASLPGLLSTTTVFGAREELPDEPEPGTVGLVLAEGTVFGESAIQPGYFADHQPPALLMLHPPSETMPSLPECTGAASGCVLLPGLPYLGLEHRAAWVEAEADGTITSMVSRVGVDPISHPDTAILAMLLAA
Bibliography
No article yet recorded