Gene ML0072c (sodB, sod)
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable superoxide dismutase SodA |
| Comments | ML0072c, len: 207 aa. Probable sodA (alternate gene names: sodB, sod), superoxide dismutase (EC 1.15.1.1) (see citations below), highly similar to Rv3846|SODF_MYCTU|P17670 sodA, superoxide dismutase from M. tuberculosis (207 aa), Fasta scores: E(): 0, (80.1% identity in 206 aa overlap); and to many other mycobacterial superoxide dismutases. Previously sequenced as SODM_MYCLE|P13367 (206 aa), Fasta scores: E(): 0, (100.0% identity in 206 aa overlap). Contains Pfam match to entry PF00081 sodfe, Iron/manganese superoxide dismutases (SODM). Contains PS00088 Manganese and iron superoxide dismutases signature. Belongs to the iron/manganese superoxide dismutase family. In M. tuberculosis has been found extracellularly, no signal sequence is present. An alternative secretory pathway may be used. |
| Functional category | Virulence, detoxification, adaptation |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 92647 | 93270 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0072c|sodA
VAEYTLPDLDWDYAALEPHISGEINEIHHTKHHAAYVKGVNDALAKLDEARAKDDHSAIFLNEKNLAFHLGGHVNHSIWWKNLSPNGGDKPTGGLATDIDETFGSFDKFRAQFSAAANGLQGSGWAVLGYDTLGNKLLTFQLYDQQANVSLGIIPLLQVDMWEHAFYLQYKNVKADYVKAFWNVVNWADVQSRYMAATSKTQGLIFD
Bibliography
No article yet recorded
