Gene ML0079
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable phosphoglycerate mutase (phosphoglyceromutase) (phosphoglycerate phosphomutase) |
Comments | ML0079, len: 231 aa. Probable phosphoglycerate mutase (EC 5.4.2.-), highly similar to Rv3837c|P96241|AL123456 probable phosphoglycerate mutase from M. tuberculosis (232 aa), Fasta scores: E(): 0, (71.6% identity in 232 aa overlap). Similar to Q9ZAX0|U73808 pgm, 2,3-PDG dependent phosphoglycerate mutase from Amycolatopsis methanolica (205 aa), Fasta scores: E(): 9.3e-24, (39.7% identity in 204 aa overlap). Also similar to ML1452 from M. leprae. Contains Pfam match to entry PF00300 PGAM, Phosphoglycerate mutase family. Contains PS00175 Phosphoglycerate mutase family phosphohistidine signature. |
Functional category | Intermediary metabolism and respiration |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 99390 | 100085 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0079|ML0079 MSSRLVLLRHGQSYGNVEGRLDTRPPGASLTPFGRDQARVFAQAAGRPVLLVHSVAIRALETAAVLGAEFDVPIREIAGIHEVQVGELENRNDDDAIAEFNAIYDRWHHGELDVPLPGGETANDVLDRYLPVLVDLRMRYLDDGDWTGDVVVVSHGAAIRLVSAVLAEVDGRFALENRVNNAESVVLVPVTDGRWSCVRWGALTPPFYPHLHRPDSTLVTDVVMSGRDSLG
Bibliography
No article yet recorded