Gene ML0091c (erp, P36)
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Exported repetitive protein precursor PirG (28 KDa antigen precursor) (cell surface protein) |
Comments | ML0091c, len: 236 aa. Probable pirG (alternate gene names: P36 or erp for Exported Repeated Protein), cell surface protein precursor (see citations below), similar to Rv3810|ERP_MYCTU|Q50793 pirG, exported repetitive protein precursor from M. tuberculosis (284 aa), Fasta scores: E(): 1.8e-23, (52.7% identity in 281 aa overlap). Previously sequenced as 28KD_MYCLE|P19361 (236 aa), Fasta scores: E(): 0, (99.6% identity in 236 aa overlap). Contains a probable N-terminal signal sequence. |
Functional category | Cell wall and cell processes |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 113153 | 113863 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0091c|pirG VPNRRRCKLSTAISTVATLAIASPCAYFLVYEPTASAKPAAKHYEFKQAASIADLPGEVLDAISQGLSQFGINLPPVPSLTGTDDPGNGLRTPGLTSPDLTNQELGTPVLTAPGTGLTPPVTGSPICTAPDLNLGGTCPSEVPITTPISLDPGTDGTYPILGDPSTLGGTSPISTSSGELVNDLLKVANQLGASQVMDLIKGVVMPAVMQGVQNGNVAGDLSGSVTPAAISLIPVT
Bibliography
No article yet recorded