Gene ML0095
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved integral membrane protein |
| Comments | ML0095, len: 302 aa. Possible conserved integral membrane protein, highly similar to Rv3806c|O53583|AL123456 integral membrane protein from M. tuberculosis (302 aa), Fasta scores: E(): 0, (83.8% identity in 302 aa overlap); and similar to other bacterial putative membrane proteins e.g. CAB89063|AL353872 putative integral membrane protein SC5G8.12 from Streptomyces coelicolor (322 aa), Fasta scores: E(): 0, (48.6% identity in 290 aa overlap); and NOEC_AZOCA|Q43967 possible integral membrane protein found near nod locus from Azorhizobium caulinodans noeC (307 aa), Fasta scores: E(): 1.1e-12, (31.4% identity in 191 aa overlap). Also similar to Q8NLQ9 4-hydroxybenzoate polyprenyltransferases from Corynebacterium glutamicum (332 aa), Fasta scores: E(): 0, (60.8% identity in 293 aa overlap). Contains hydrophobic, possible membrane-spanning regions. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 117870 | 118778 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0095|ubiA
MSEDVMIGSSGNLVIGVVKAIRPRQWVKNVLVLAAPLAGLGGGMHYRYAELLTEVSLAFVVFSLAASSVYLINDVRDIEADQEHPTKRFRPIAAGVVTEWLAYTLAVVLGVASLVVAWLMTPNLALVMVIYIGMQLGYCFGLKHQAVVDICIVSSAYLIRAIAGGVATNIPLSQWFLLTAAFGSLFMVAGKRYAELQLTERTGAAIRKSLESYTSTYLRFVWTLSATAVVMCYGLWAFERDRHSGSWFAVSMVPFTIAILRYAVDVDGGLAGEPEGIALRDRVLQLLALTWAGTIGAAVVFG
Bibliography
No article yet recorded
