Gene ML0097 (mpt44, 85A)
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Involved in cell wall mycoloylation. Proteins of the antigen 85 complex are responsible for the high affinity of mycobacteria to fibronectin. Possesses a mycolyltransferase activity required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity. |
| Product | Secreted antigen 85A FbpA (mycolyl transferase 85A) (fibronectin-binding protein A) (antigen 85 complex A) |
| Comments | ML0097, len: 330 aa. Probable fbpA, precursor of the 85-A antigen (fibronectin-binding protein A) (EC 2.3.1.-) (see citations below), highly similar to Rv3804|A85A_MYCTU|P17944 fbpA, antigen 85-A precursors from M. tuberculosis (338 aa), Fasta scores: E(): 0, (83.0% identity in 329 aa overlap). Also similar to the B- and C- proteins of the mycobacterial antigen 85 complexes. Similar to N-terminal region of CSP1_CORGL|Q01377 PS1 protein precursor from Corynebacterium glutamicum csp1 (657 aa), Fasta scores: E(): 5.2e-31, (38.6% identity in 290 aa overlap). Also similar to ML0098, ML2028 and ML2655 from M. leprae. Previously sequenced as A85A_MYCLE|Q05861 (330 aa), Fasta scores: E(): 0, (100.0% identity in 330 aa overlap). Contains probable N-terminal signal sequence. Contains Pfam match to entry PF00756 Esterase, Putative esterase. |
| Functional category | Lipid metabolism |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 121157 | 122149 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0097|fbpA
MKFVDRFRGAVAGMLRRLVVEAMGVALLSALIGVVGSAPAEAFSRPGLPVEYLQVPSPSMGRDIKVQFQNGGANSPALYLLDGLRAQDDFSGWDINTTAFEWYYQSGISVVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQYLQSNKQIKPTGSAAVGLSMAGLSALTLAIYHPDQFIYVGSMSGLLDPSNAMGPSLIGLAMGDAGGYKAADMWGPSTDPAWKRNDPTVNVGTLIANNTRIWMYCGNGKPTELGGNNLPAKLLEGLVRTSNIKFQDGYNAGGGHNAVFNFPDSGTHSWEYWGEQLNDMKPDLQQYLGATPGA
Bibliography
No article yet recorded
