Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in cell wall mycoloylation. Proteins of the antigen 85 complex are responsible for the high affinity of mycobacteria to fibronectin. Possesses a mycolyltransferase activity required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity.
ProductSecreted antigen 85A FbpA (mycolyl transferase 85A) (fibronectin-binding protein A) (antigen 85 complex A)
CommentsML0097, len: 330 aa. Probable fbpA, precursor of the 85-A antigen (fibronectin-binding protein A) (EC 2.3.1.-) (see citations below), highly similar to Rv3804|A85A_MYCTU|P17944 fbpA, antigen 85-A precursors from M. tuberculosis (338 aa), Fasta scores: E(): 0, (83.0% identity in 329 aa overlap). Also similar to the B- and C- proteins of the mycobacterial antigen 85 complexes. Similar to N-terminal region of CSP1_CORGL|Q01377 PS1 protein precursor from Corynebacterium glutamicum csp1 (657 aa), Fasta scores: E(): 5.2e-31, (38.6% identity in 290 aa overlap). Also similar to ML0098, ML2028 and ML2655 from M. leprae. Previously sequenced as A85A_MYCLE|Q05861 (330 aa), Fasta scores: E(): 0, (100.0% identity in 330 aa overlap). Contains probable N-terminal signal sequence. Contains Pfam match to entry PF00756 Esterase, Putative esterase.
Functional categoryLipid metabolism
Coordinates
TypeStartEndOrientation
CDS121157122149+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium leprae TN|ML0097|fbpA
MKFVDRFRGAVAGMLRRLVVEAMGVALLSALIGVVGSAPAEAFSRPGLPVEYLQVPSPSMGRDIKVQFQNGGANSPALYLLDGLRAQDDFSGWDINTTAFEWYYQSGISVVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQYLQSNKQIKPTGSAAVGLSMAGLSALTLAIYHPDQFIYVGSMSGLLDPSNAMGPSLIGLAMGDAGGYKAADMWGPSTDPAWKRNDPTVNVGTLIANNTRIWMYCGNGKPTELGGNNLPAKLLEGLVRTSNIKFQDGYNAGGGHNAVFNFPDSGTHSWEYWGEQLNDMKPDLQQYLGATPGA
      
Bibliography
No article yet recorded