Gene ML0110c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved transmembrane protein |
| Comments | ML0110c, len: 123 aa. Probable conserved transmembrane protein, highly similar to Rv3789|Y1I9_MYCTU|P72055 hypothetical protein from M. tuberculosis (121 aa), Fasta scores: E(): 0, (73.0% identity in 122 aa overlap). Contains hydrophobic, possible membrane-spanning regions. |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 151578 | 151949 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0110c|ML0110c
VLRFIVTGSLATAVDFSVYVTLYRGGGLQVDLAKFTSVVIGTITSYMINRRWTFQMSPSTTRFAAVMALYGITFAVQMGLNHLCLFLFHYQEPWAIPIAFVIAQGLATVINFIVQRVVIFRIR
Bibliography
No article yet recorded