Gene ML0118c 
in Mycobacterium leprae TN
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Probable oxidireductase | 
| Comments | ML0118c, len: 336 aa. Probable oxidoreductase (EC 1.-.-.-), highly similar to Rv3777|P72043 putative oxidireductase from M. tuberculosis (328 aa). Similar to many oxidoreductases from both bacteria and higher organisms e.g. QOR_MOUSE|P47199 cryZ, quinone oxidoreductase from Mus musculus (331 aa), Fasta scores: E(): 5.5e-21, (31.0% identity in 306 aa overlap). And similar to domains of polyketide synthases ML0135, ML0139, ML1229 and ML2355 from M. leprae. Contains Pfam match to entry PF00107 adh_zinc, Zinc-binding dehydrogenases. | 
| Functional category | Intermediary metabolism and respiration | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 159249 | 160259 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium leprae TN|ML0118c|ML0118c
MHAIVAESANQMVWREVPDVTAGPGEVLIEVAASGVNRADVLQVAGKYPHPPGASAIIGMEVAGVVAAVSSGVTEWSVGQEVCALLAGGGYAEYVAVPASQVMPIPKGVNVVDSAGIPEVACTVWSNLVMAAHLSAGQLLLLHGGTSGIGSHGIQVARALGAKVAVTAGSEEKLEFCRALGAQITINYRDEDFVARLQQQNGGADVILDIMGAAYLDRNIDALAIDGQLIVIGLQGGVKGELNLGKVLSKRARIIGSTLRARPVNGPNSKSEIVAAVTASIWPMIADGSVRPIIGARMAVQQAADAHQLLLSGKVSGKIVLTVAGSGTETLLSRHH
      
    Bibliography
    No article yet recorded