Gene ML0118c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable oxidireductase |
| Comments | ML0118c, len: 336 aa. Probable oxidoreductase (EC 1.-.-.-), highly similar to Rv3777|P72043 putative oxidireductase from M. tuberculosis (328 aa). Similar to many oxidoreductases from both bacteria and higher organisms e.g. QOR_MOUSE|P47199 cryZ, quinone oxidoreductase from Mus musculus (331 aa), Fasta scores: E(): 5.5e-21, (31.0% identity in 306 aa overlap). And similar to domains of polyketide synthases ML0135, ML0139, ML1229 and ML2355 from M. leprae. Contains Pfam match to entry PF00107 adh_zinc, Zinc-binding dehydrogenases. |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 159249 | 160259 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0118c|ML0118c
MHAIVAESANQMVWREVPDVTAGPGEVLIEVAASGVNRADVLQVAGKYPHPPGASAIIGMEVAGVVAAVSSGVTEWSVGQEVCALLAGGGYAEYVAVPASQVMPIPKGVNVVDSAGIPEVACTVWSNLVMAAHLSAGQLLLLHGGTSGIGSHGIQVARALGAKVAVTAGSEEKLEFCRALGAQITINYRDEDFVARLQQQNGGADVILDIMGAAYLDRNIDALAIDGQLIVIGLQGGVKGELNLGKVLSKRARIIGSTLRARPVNGPNSKSEIVAAVTASIWPMIADGSVRPIIGARMAVQQAADAHQLLLSGKVSGKIVLTVAGSGTETLLSRHH
Bibliography
No article yet recorded