Gene ML0136
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved lipoprotein LppX |
| Comments | ML0136, len: 233 aa. Probable lppX, conserved lipoprotein, highly similar to Rv2945c|LPPX_MYCTU|Z83858 lppX, conserved lipoprotein from M. tuberculosis (233 aa), Fasta scores: E(): 0, (76.4% identity in 233 aa overlap); and similar to other probable mycobacterial lipoproteins e.g. LPRG_MYCTU|AJ000500 lprG, 27 kDa lipoprotein antigen from Mycobacterium bovis (236 aa), Fasta scores: E(): 2.5e-13, (31.2% identity in 202 aa overlap). And is similar to ML0557 from M. leprae. Contains a probable N-terminal signal sequence. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 188551 | 189252 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0136|lppX
MNDRKWVTSSVMLVTLSACLALGLSGCSSTKPDAQEQSSSSSPASSDPALTAEIKQSLETTKALSSVHVVVQTTGKVDALLGISNADVDVQANPLAVKGTCTYNDQPGVPFRVLGDNISVKLFDDWSNLGSISDLSTSHVLDPNTGITQVLSGVINLQAQGTEVVDRIPTNKITGTVPTSSVKMLDPKAKGSKLATVWIAQDGSHHLVRASIDLGSGSIQLTQSKWNEPVNTN
Bibliography
No article yet recorded