Gene ML0151c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0151c, len: 105 aa. Conserved hypothetical protein, highly similar to Rv0948c|Y948_MYCTU|P71562 hypothetical protein from M. tuberculosis (105 aa), Fasta scores: E(): 1.9e-32, (83.8% identity in 105 aa overlap). Also similar to CAB82023|AL161755 hypothetical protein SCD63.16C from Streptomyces coelicolor (110 aa), Fasta scores: E(): 3.9e-06, (44.4% identity in 72 aa overlap); and to the N-terminus of two chorismate mutase/prephenate dehydratase. |
| Functional category | Conserved hypotheticals, Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 213175 | 213492 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0151c|ML0151c
MRPEPPHHENAELTEMNTEVVEAPLLTDIEELREEIDRLDAQILATVKRRAEVSQAIGKVRMASGGTRLVHSREMKVIERYSELGPDGKDLAILLLRLGRGRLGH
Bibliography
No article yet recorded