Gene ML0173
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable 50S ribosomal protein L32 RpmF |
| Comments | ML0173, len: 57 aa. Probable rpmF, ribosomal protein L32, similar to many e.g. Rv0979A|P58287|RL32_MYCTU 50S ribosomal protein L32 from M. tuberculosis (57 aa), fasta scores: E(): 4.9e-19, (84.2.462% identity in 57 aa overlap); and R322_STRCO|Q9RL50 probable 50S ribosomal protein from Streptomyces coelicolor (56 aa), fasta scores: E(): 1.5e-09, (63.462% identity in 52 aa overlap). Belongs to the L32P family of ribosomal proteins. |
| Functional category | Information pathways |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 240237 | 240410 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0173|rpmF
MATPKRRMSRANTRSRRAQWKAARTELVGVTVAGQRHKVPRRLLKAARLGLIDLDRR
Bibliography
No article yet recorded