Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to be involved in molybdopterin biosynthesis. Catalyzes the dehydratation of 4A-hydroxytetrahydropterins [Catalytic activity: (6R)-6-(L-erythro-1,2-dihydroxypropyl)-5,6,7,8-tetrahydro-4A-hydroxypterin = (6R)-6-(L-erythro-1,2-dihydroxypropyl)-7,8-dihydro-6H-pterin + H(2)O]
ProductPossible pterin-4-alpha-carbinolamine dehydratase MoaB2 (4-alpha-hydroxy-tetrahydropterin dehydratase) (pterin-4-A-carbinolamine dehydratase) (phenylalanine hydroxylase-stimulating protein) (PHS) (pterin carbinolamine dehydratase) (PCD)
CommentsML0177, len: 181 aa. Possible moaB2, pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96), highly similar to Rv0984|O53897|AL123456 moaB2, possible pterin-4-alpha-carbinolamine dehydratase from M. tuberculosis (181 aa), Fasta scores: E(): 0, (92.7% identity in 179 aa overlap). Similar to many others e.g. Q9RKA9 Molybdenum cofactor biosynthesis protein from Streptomyces coelicolor A3(2) (179 aa), Fasta scores: E(): 5e-21, (50.0% identity in 150 aa overlap); and to the C-terminal halves of CNX1_ARATH|Q39054 cnx1, multifunctional two-domain protein involved in molybdenum cofactor biosynthesis from Arabidopsis thaliana (670 aa), Fasta scores: E(): 7.7e-10, (36.4% identity in 187 aa overlap); and MOCB_SYNP|Q56208 moaCB, molybdenum cofactor biosynthesis protein from Synechococcus sp. (strain PCC 7942) (319 aa), Fasta scores: E(): 1.3e-09, (35.9% identity in 142 aa overlap). Previously sequenced as Q9Z5G5|AL035500 (181 aa), Fasta scores: E(): 0, (99.4% identity in 181 aa overlap).
Functional categoryIntermediary metabolism and respiration
Coordinates
TypeStartEndOrientation
CDS244225244770+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium leprae TN|ML0177|moaB
VLVDKQLSELGYTVAPMEKGVELVVGRALIVVVDDRTAHGDEDHSGPLVTELLTEAGFVVDGVVAVAADEVEIRNALNTAVIGGVDLVVSVGGTGVTPRDVAPEATREILDREILGIAEAIRASGLSAGITDAGLSRGLAGVSGSTLVVNLAGSRYAVRDGMATLNPLATQIIGQLSSLEI
      
Bibliography
No article yet recorded