Gene ML0178c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible large-conductance ion mechanosensitive channel MscL |
| Comments | ML0178c, len: 154 aa. Possible mscL, large conductance mechanosensitive ion channel (integral membrane protein) (see citations below), highly similar to Rv0985c|MSCL_MYCTU|O53898 mscL, possible mechanosensitive channel protein from M. tuberculosis (151 aa), Fasta scores: E(): 0, (71.0% identity in 155 aa overlap). Similar to many others e.g. MSCL_ECOLI|P23867 mscL, large-conductance mechanosensitive channel from Escherichia coli (136 aa), Fasta scores: E(): 1.3e-07, (32.1% identity in 134 aa overlap). Previously sequenced as MSCL_MYCLE|Q9Z5G4 (154 aa), Fasta scores: E(): 0, (100.0% identity in 154 aa overlap). Contains hydrophobic, possible membrane-spanning regions. Contains Pfam match to entry PF01741 MscL, Large-conductance mechanosensitive channel, MscL. Contains PS01327 Large-conductance mechanosensitive channels mscL family signature. Belongs to the MSCL family. |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 244787 | 245251 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0178c|mscL
MFRGFKEFLSRGNIVDLAVAVVIGTAFTALITKFTDSIITPLINRVGVNQQTNISPLRIDIGGDQAIDLNIVLSAAINFLLIALVVYFLVVLPYTTIRKHGEVEQFDTDLIGNQVVLLAEIRDLLAQSNGAPSGRHVDTADLTPTPNHEPRADT
Bibliography
No article yet recorded