Gene ML0180c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Conserved hypothetical Serine rich protein |
Comments | ML0180c, len: 99 aa. Conserved hypothetical ser-rich protein (especially in C-terminus), highly similar to Rv0991c|O05574|AL123456 hypothetical protein with Ser-rich C-terminus from M. tuberculosis (110 aa), Fasta scores: E(): 1.1e-23, (78.5% identity in 93 aa overlap). Similar to other bacterial Ser-rich hypothetical proteins e.g. CAB90971|AL355832 hypothetical protein SCE22.04 from Streptomyces coelicolor (110 aa), Fasta scores: E(): 2.6e-15, (54.5% identity in 99 aa overlap). Previously sequenced as Q9Z5G3|AL035500 (120 aa), Fasta scores: E(): 1.1e-32, (100.0% identity in 99 aa overlap). |
Functional category | Conserved hypotheticals |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 246049 | 246348 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0180c|ML0180c VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGSGFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
Bibliography
No article yet recorded