Gene ML0181c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0181c, len: 197 aa. Conserved hypothetical protein, highly similar to Rv0992c|O05575|AL123456 conserved hypothetical protein from M. tuberculosis (197 aa), Fasta scores: E(): 0, (72.6% identity in 197 aa overlap). Similar to many hypothetical proteins and shows weak similarity to methenyltetrahydrofolate synthetases e.g. Q8NS05 5-formyltetrahydrofolate cyclo-ligase from Corynebacterium glutamicum (190 aa), Fasta scores: E(): 3.3e-15, (35.1% identity in 188 aa overlap). Previously sequenced as Q9Z5G2|AL035500 (197 aa), Fasta scores: E(): 0, (100.0% identity in 197 aa overlap). Contains Pfam match to entry PF01812 5-FTHF_cyc-lig, 5-formyltetrahydrofolate cyclo-ligase. |
| Functional category | Conserved hypotheticals |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 246423 | 247016 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0181c|ML0181c
MVTASKATLRKQLLAARRSVADDIRAAETKMLSQHLELLVNSASTVCAYVPVGTEPGAIEMLDVLLRKTGRVLLPVARTGDDEIPLPLQWGEYRPGGLTSGPWGLLEPPELRLPESALAEANLVLVPALAVDHHGVRLGRGGGFYDRSLAGRDPHTLLIALVRDTELLNELPSEPHDVRMTHAVTPERGVIALPNSE
Bibliography
No article yet recorded
