Gene ML0182
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable UTP--glucose-1-phosphate uridylyltransferase GalU (UDP-glucose pyrophosphorylase) (UDPGP) (alpha-D-glucosyls-1-phosphate uridylyltransferase) (uridine diphosphoglucose pyrophosphorylase) |
| Comments | ML0182, len: 306 aa. Probable galU, UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9), highly similar to Rv0993|O05576|AL123456 galU, UTP--glucose-1-phosphate uridylyltransferase from M. tuberculosis (306 aa), Fasta scores: E(): 0, (89.7% identity in 302 aa overlap). Similar to many others e.g. GALU_ECOLI|P25520 galU, UTP--glucose-1-phosphate uridylyltransferase from Escherichia coli (301 aa), Fasta scores: E(): 5.4e-33, (38.8% identity in 299 aa overlap). Previously sequenced as Q9Z5G1|AL035500 (306 aa), Fasta scores: E(): 0, (100.0% identity in 306 aa overlap). Contains Pfam match to entry PF00483 NTP_transferase, Nucleotidyl transferase. Belongs to the prokaryotic UDPGP family. |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 247094 | 248014 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0182|galU
MSLLLSAQVPIPFTAIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAAAGAERLVIVTSEGKDGVVAHFVQDLVLEGTLLARGNKAMLAKVRRAPELIKVESVVQAEPLGLGHAIGCAEPTLAPDEDAVSVLLPDDLVLPTGVLETMSKVRASRGGTVLCAIEVASEEISSYGVFDVEPVPGGDNPNVLKVIGMVEKPKAEDAPSTFAAAGRYVLDRAIFDALRRVSRGTGGEVQITDAIALLIKEGHPVHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRRWLVERLGLIEQ
Bibliography
No article yet recorded