Gene ML0183
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable molybdopterin biosynthesis protein MoeA1 |
| Comments | ML0183, len: 424 aa. Probable moeA1, molybdopterin biosynthesis protein, highly similar to Rv0994|MOEA_MYCTU|O05577 moeA, probable molybdopterin biosynthesis protein from M. tuberculosis (426 aa), Fasta scores: E(): 0, (88.3% identity in 426 aa overlap). Similar to many e.g. MOEA_ECOLI|P12281 moeA, molybdopterin biosynthesis protein from Escherichia coli (411 aa), Fasta scores: E(): 3.3e-23, (31.4% identity in 392 aa overlap). Previously sequenced as Q9Z5G0|AL035500 (424 aa), Fasta scores: E(): 0, (99.8% identity in 424 aa overlap). Contains Pfam match to entry PF00994 MoCF_biosynth, Molybdenum cofactor biosynthesis protein. Note that previously known as moeA. |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 248102 | 249376 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0183|moeA1
VRSVEEQQARILAAAVVPRPVRVAIAEAQGLMCAEEVMTERPLPGFDQAAIDGYAVRSVDVSGIGESDGGESGSSDEDGRYVLTLPVMGTIEAGARTPSRLLPHQAVRVQTGAPLPVLADAVLPVRWTDGGMSRVRILRGAPSGAYVRRVGDDVQPGDVAVRAGTIIGAAQVGLLAAVGRERVLVHPRPRLSIMAVGGELVDISRTPGNGQVYDVNSYALTAAGRDAGAEVNRIGIVSNNLKEFGEVVEGQISRAEVVVIAGGVGGAAAEAVRAVLSEIGEMEVVRVAMHPGSVQGFGQLGREGVPTFLLPANPVSALVVFEVMVRPLIRLSLGKRQPMRRIVQARTLSPITSVAGRKGYLRGQLMRDQDTGEYLVQALGGALGASSHLLATLAEANCLVVIPSGAEQIRTGEVVDVAFLAQRG
Bibliography
No article yet recorded
