Gene ML0193
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0193, len: 281 aa. Conserved hypothetical protein, highly similar to Rv1003|YA03_MYCTU|O05588 conserved hypothetical protein from M. tuberculosis (285 aa), Fasta scores: E(): 0, (74.0% identity in 277 aa overlap). Similar to many bacterial hypothetical proteins e.g. Q9RKD4|AL132674 conserved hypothetical protein SCE87.04C from Streptomyces coelicolor (286 aa), Fasta scores: E(): 0, (50.5% identity in 277 aa overlap). Contains Pfam match to entry PF00590 TP_methylase, Tetrapyrrole (Corrin/Porphyrin) Methylases. |
| Functional category | Conserved hypotheticals |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 258646 | 259491 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0193|ML0193
MTYGRLLLGATPLGQPLDASRRLTDALCCADVVAAEDTRRARTLAKTLGVVITGRVISLFDQIEAVRVSALVAEIEAGATVLVISDAGMSVISDPGYRLVAACIAAGLPVRCLPGPSAVMTALAVSGLSSEKFCFEGFAPRKSSARRTWLASLADERRTCVFFESPRRLAACLRDAVDQLGSARPVVVCRELTKVHEEVVRGSLDELATWAANGVLGEITVVLAGATPRADLFLLVPEVENLVAGGARVKDACGQVAAVHSSVRSRQLYDAVLRARQVSSR
Bibliography
No article yet recorded