Gene ML0198
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable cold shock protein A CspA |
Comments | ML0198, len: 67 aa. Probable cspA, cold shock protein A, identical to Rv3648c|CSPA_MYCTU|O06360 probable cspA, cold shock protein A from M. tuberculosis (67 aa), Fasta scores: E(): 3.9e-27, (97.0% identity in 67 aa overlap). Similar to many others e.g. CSP_ARTGO|P54584 csp, cold shock protein from Arthrobacter globiformis (67 aa), Fasta scores: E(): 8.8e-19, (71.6% identity in 67 aa overlap). Previously sequenced as O69550|AL023093 (67 aa), Fasta scores: E(): 1.2e-27, (100.0% identity in 67 aa overlap). Also similar to ML2147 from M. leprae. Contains Pfam match to entry PF00313 CSD, 'Cold-shock' DNA-binding domain. Contains PS00352 'Cold-shock' DNA-binding domain signature. |
Functional category | Virulence, detoxification, adaptation |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 264898 | 265101 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0198|cspA MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEFEIGHSPKGPQATGVRSV
Bibliography
No article yet recorded