Gene ML0207
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Possible transferase (possibly glycosyltransferase) |
Comments | ML0207, len: 239 aa. Possible transferase (EC 2.-.-.-), more specifically a glycosyltransferase (EC 2.4.-.-), highly similar to Rv3631|O06376|AL123456 possible glycosyltransferase from M. tuberculosis (241 aa), Fasta scores: E(): 0, (80.8% identity in 239 aa overlap). Similar to many bacterial hypothetical proteins and dolichyl-phosphate mannose synthases. Previously sequenced as O69542|PS50167 (239 aa), Fasta scores: E(): 0, (99.6% identity in 239 aa overlap). Also similar to ML1440 from M. leprae. Contains Pfam match to entry PF00535 Glycos_transf_2, Glycosyl transferases. |
Functional category | Intermediary metabolism and respiration |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 279051 | 279770 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0207|ML0207 LGIETCYPGVWIVIPAFNEAAIIGEVVTDVRAVFDHVVCVDDGSADGTGEIALRAGAHLVRHPVNLGQGAAIQTGVEYARRQPAAQVFATFDADGQHRVKDLAALVDRLGAHDVDVVIGTRFGRLDGGRLPILKGPPFLKRVVLRTAARLSRRGRRLGLTDTNNGLRVFNKKVADGLDITMTGMSHANEFVMLIADNHWRVDEVPVEVLYTEYSKSKGQPLLNGVNIIFDGFLRGRMPK
Bibliography
No article yet recorded