Gene ML0208
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved membrane protein |
| Comments | ML0208, len: 113 aa. Possible conserved membrane protein, highly similar to Rv3632|O06375|AL123456 conserved membrane protein from M. tuberculosis (114 aa), Fasta scores: E(): 0, (82.0% identity in 111 aa overlap). Previously sequenced as O69541|AL023093 (113 aa), Fasta scores: E(): 0, (100.0% identity in 113 aa overlap). Contains hydrophobic, possible membrane-spanning regions. |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 279784 | 280125 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0208|ML0208
MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRPNDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLARVVALEGARAPEPF
Bibliography
No article yet recorded