Gene ML0210c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable inorganic pyrophosphatase Ppa (pyrophosphate phospho-hydrolase_ (PPase) (inorganic diphosphatase) (Diphosphate phospho-hydrolase) |
| Comments | ML0210c, len: 162 aa. Probable ppa, inorganic pyrophosphatase (EC 3.6.1.1), highly similar to Rv3628|IPYR_MYCTU|O06379 ppa, inorganic pyrophosphatase from M. tuberculosis (162 aa), Fasta scores: E(): 0, (89.5% identity in 162 aa overlap). Similar to many others e.g. IPYR_SULAC|P50308 ppa, inorganic pyrophosphatase from Sulfolobus acidocaldarius (173 aa), Fasta scores: E(): 1.1e-27, (45.9% identity in 159 aa overlap); and Q9X8I9|IPYR_STRCO inorganic pyrophosphatase from Streptomyces coelicolor A3(2) (163 aa). Previously sequenced as IPYR_MYCLE|O69540 (162 aa), Fasta scores: E(): 0, (99.4% identity in 162 aa overlap). Contains Pfam match to entry PF00719 Pyrophosphatase, Inorganic pyrophosphatase. Contains PS00387 Inorganic pyrophosphatase signature. |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 281543 | 282031 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0210c|ppa
VQFDVTIEIPKGQRNKYEVDHKTGRVRLDRYLYTPMAYPTDYGFIEDTLGEDGDPLDALVLLPEPLFPGVLVEARPVGMFRMVDEHGGDDKVLCVPVNDHRWDHIHGIIDVPTFELDAIKHFFVHYKDLEPGKFVKAADWVGRDEAEAEVQRSVERFKAGGH
Bibliography
No article yet recorded
