Gene ML0227
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved secreted or membrane protein |
| Comments | ML0227, len: 158 aa. Probable conserved secreted or membrane protein, highly similar to Rv3605c|O06277|AL123456 conserved secreted or membrane protein from M. tuberculosis (158 aa), Fasta scores: E(): 0, (85.4% identity in 158 aa overlap). Previously sequenced as O69527|AL023093 (158 aa), Fasta scores: E(): 0, (100.0% identity in 158 aa overlap). Contains hydrophobic, possible membrane-spanning regions. |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 298516 | 298992 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0227|ML0227
MGPTRKRDLTAAMIGAAVVGYLLVLVLYRWFPPITVWTGLSLLAVAIPEALWARYVRTKISDGEIGDGPGWLHPLAVAHSLMVAKASAWVGALVLGWWVGVLVYFLPRWPWLRVADKDTSGTVVAALSALALLVAALWLQHCCKSPQDPTEHGEGAEN
Bibliography
No article yet recorded