Gene ML0228
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved transmembrane protein rich in alanine, arginine and proline |
| Comments | ML0228, len: 432 aa. Probable conserved ala-, arg-, pro-rich transmembrane protein, similar to Rv3604c|O06278|AL123456 ala-, arg-, pro-rich transmembrane protein from M. tuberculosis (397 aa), Fasta scores: E(): 0, (59.7% identity in 432 aa overlap). Previously sequenced as O69526|AL023093 (432 aa), Fasta scores: E(): 0, (100.0% identity in 432 aa overlap). Contains hydrophobic, possible membrane-spanning regions. |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 299138 | 300436 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0228|ML0228
MTVLSRGGRVRRGGRRPGWVLLTVSLILAMGASSALVFTNRVELLKLAVILALWAAVAGAFVSVFYRRQSDADQSRVRNLKLVYDLQLDREISARREYELTVESQLRRELASELRSQAADEVLALRAELAALRTNLEILFDTDLQHRPALAGAEAPQAKAAPPTCAYSNWVRDGQSKPVDWVPSNRVTSVRQDRVTNSADDTSIIDVPEEPLLPPRGQAPQQGGVLPHFEDPPSQSDSRFEPRHRPPRSAPLQELLQPHMKDWQPDAADEQWLPPGTQDSAWTDVESASASVAAPSGRRRRSRHSSLDEAAASSPGEAETAQQHSGSGRRARSRHSAEYRAYSIEGITAKGSTPISQPTPPAGPAFAEQPPRLVPASPSDPVPRHRSADLLTDGVKGRDLAAGGQSVADLMARLGAESTDGGRRRRREGHYA
Bibliography
No article yet recorded