Gene ML0230
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable pantoate--beta-alanine ligase PanC (pantothenate synthetase) (pantoate activating enzyme) |
| Comments | ML0230, len: 313 aa. Probable panC, pantoate--beta-alanine ligase (EC 6.3.2.1), highly similar to Rv3602c|PANC_MYCTU|O06280 panC, pantoate--beta-alanine ligase from M. tuberculosis (309 aa), Fasta scores: E(): 0, (82.2% identity in 297 aa overlap). Similar to many others e.g. PANC_ECOL|P31663 panC, pantoate--beta-alanine ligase from Escherichia coli (283 aa), Fasta scores: E(): 0, (46.1% identity in 269 aa overlap). Previously sequenced as PANC_MYCLE|O69524 (191 aa), Fasta scores: E(): 0, (100.0% identity in 191 aa overlap). Belongs to the pantothenate synthetase family. |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 301463 | 302404 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0230|panC
MTNSRQPAFNPGELNVYSTPRDVTNVSSALRHTGRRVMLVPTMGALHNGHLALVRAAKRVPGSVVVVSIFVNPLQFGAAEDLDTYPCTFDDDLALLRAEDVEIVFTPTAAAMYPHGLRTTVRPGALAFELEGGPRPNHFDGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQMVADLNVDVVVVGVPTVREVDGLAMSSRNCYLDPVQRDLAAALSAALTAGAHAATGGAQAALDAARAVLDATPGLVVDYVELRDAGLGPMRDNTFGRLLVAARLGATRLLDNISIEIGNFSGIASPDECRVEHAQTPWMK
Bibliography
No article yet recorded
