Gene ML0232
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML0232, len: 274 aa. Conserved hypothetical protein, highly similar to Rv3600c|O06282|AL123456 conserved hypothetical protein from M. tuberculosis (272 aa), Fasta scores: E(): 0, (90.5% identity in 274 aa overlap). Similar to several other bacterial hypothetical proteins e.g. Q9X8N6|AL049628 hypothetical protein SCE94.31C from Streptomyces coelicolor (265 aa), Fasta scores: E(): 0, (52.0% identity in 269 aa overlap); and other bacterial proteins e.g. Q9F985 putative 32 kDa replication protein from Bacillus stearothermophilus (258 aa). |
| Functional category | Conserved hypotheticals |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 302835 | 303659 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0232|ML0232
VLLAIDVRNTHTVVGLLSGSKEHAKVVQQWRIRTESEVTADELALIIDGLIGDDSERLAGAAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPLLVDNPKEVGADRIVNCLAAFHKFGQAAIVVDFGSSICVDVVSAKGEFLGGAIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGVVFGFAGLVDGLVGRMRQDVEEFSGDLGNRVAVVATGHTAPLLLPELHTVDHYDRHLTLHGLRLVFERNREAQRGRLKTAR
Bibliography
No article yet recorded