Gene ML0244c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable peptidyl-tRNA hydrolase Pth |
| Comments | ML0244c, len: 199 aa. Probable pth, peptidyl-tRNA hydrolase (EC 3.1.1.29), highly similar to Rv1014c|PTH_MYCTU|P96386 pth, peptidyl-tRNA hydrolase from M. tuberculosis (191 aa), Fasta scores: E(): 0, (77.7% identity in 188 aa overlap). Similar to many e.g. PTH_ECOLI|P23932 pth, peptidyl-tRNA hydrolase from Escherichia coli (194 aa), Fasta scores: E(): 3.7e-22, (37.2% identity in 188 aa overlap). Contains Pfam match to entry PF01195 Pept_tRNA_hydro, Peptidyl-tRNA hydrolase. Contains PS01196 Peptidyl-tRNA hydrolase signature 2. Belongs to the Pth family. |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 319965 | 320564 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0244c|pth
VAEPTLASGWYPRLVVGLGNPGKNYGRTRHNVGFMVANLLAVRLGSKFEVHKRSGADVVNGRLAGCSMLVAKPRNYMNESGQQVGLLAKLYSVTPADIIIVHDDLDLDFGRIRLKLGGGEGGHNGLRSVAAALGTKDFQRVRIGIGRPTGRKDPASFVLENFTTAERMQVPTICKRAADATELLVGLGLEPAQNHVHAW
Bibliography
No article yet recorded