Gene ML0246c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved lipoprotein LpqT |
| Comments | ML0246c, len: 218 aa. Probable lpqT, conserved lipoprotein, similar to Rv1016c|LPQT_MYCTU|P96384 lpqT, probable lipoprotein from M. tuberculosis (226 aa), Fasta scores: E(): 0, (67.1% identity in 213 aa overlap). Also similar to Rv0040c|PR28_MYCTU|P71697 MTC28, proline rich 28 kDa antigen precursor from M. tuberculosis (311 aa), Fasta scores: E(): 1.3e-10, (33.3% identity in 159 aa overlap). Also similar to ML0031 from M. leprae, except at N-terminus. Contains a probable N-terminal signal sequence. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 322399 | 323055 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0246c|lpqT
MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPIPLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIAKSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNGFPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAVAQSNDIEAIIRGFVVAPK
Bibliography
No article yet recorded