Gene ML0271c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable conserved transmembrane protein |
Comments | ML0271c, len: 123 aa. Probable conserved transmembrane protein, similar to Rv0401|P95210|AL123456 probable conserved transmembrane protein from M. tuberculosis (123 aa), Fasta scores: E(): 1.9e-32, (66.9% identity in 121 aa overlap). Similar to a region of AAF69175|AC007915 hypothetical protein F27F5.3 from Arabidopsis thaliana (261 aa), Fasta scores: E(): 1.5e-06, (30.8% identity in 120 aa overlap). Previously sequenced as O69591|AL023514 (122 aa), Fasta scores: E(): 0, (100.0% identity in 122 aa overlap). Contains hydrophobic, possible membrane-spanning regions. |
Functional category | Cell wall and cell processes |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 354849 | 355220 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0271c|ML0271c MRLGQALAWLATDIVAVSVFCAVGRCSHAEGLTVADLAVTLWPFLTGTAIGWLASRGWQRPTAVVPTGVVVWLCTVVVGVALRKASSAGVVANFMVVAASTTAALFLGWRAVVELILRRRSTR
Bibliography
No article yet recorded