Gene ML0276c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0276c, len: 147 aa. Conserved hypothetical protein, highly similar to Rv0390|P95198|AL123456 conserved hypothetical protein from M. tuberculosis (140 aa), Fasta scores: E(): 0, (79.0% identity in 138 aa overlap). Also similar to other bacterial hypothetical proteins e.g. Q9ZCV8|AJ235272 RP600, hypothetical protein from Rickettsia prowazekii (123 aa), Fasta scores: E(): 8.6e-05, (35.1% identity in 134 aa overlap). Previously sequenced as O69593|AL023514 (147 aa), Fasta scores: E(): 0, (100.0% identity in 147 aa overlap). |
| Functional category | Conserved hypotheticals |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 358834 | 359277 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0276c|ML0276c
MSTEMNRPYAGDITPLQAWKMLSDNPHTVLVDVRTDAEWRFVGVPDTSSLGREVVYIEWNTSDGLPNVNFLAELQERIPPANAERGERPVVFLCRSGHRSMGAAQVATDAGISPSYNILDGFEGHLNAEGHRGETGWRAVGLPWKQL
Bibliography
No article yet recorded