Gene ML0279c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0279c, len: 218 aa. Conserved hypothetical protein, highly similar to Rv0356c|O06307|AL123456 conserved hypothetical protein from M. tuberculosis (214 aa), Fasta scores: E(): 0, (73.4% identity in 214 aa overlap); and other bacterial hypothetical proteins. Previously sequenced as O69594|AL023514 (218 aa), Fasta scores: E(): 0, (99.5% identity in 218 aa overlap). Similar to ML0457c a possible pseudogene similar to M. tuberculosis Rv0356c. |
| Functional category | Conserved hypotheticals |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 361297 | 361953 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0279c|ML0279c
VTYYSSLRPEDLPPERPKHEHYSGFPEYELANPGVGFRRFVATMRRLQDLAVSADPSDEVWYAAADRAVALVELLGPFATDEGKAPAGRVPDMPGMGSLLLPPWTLTRSGPDSVEMTGYFTRFHVGFNHAVHGGVLPLVFDHLFGMISYTAGRSISRTAFLHVDYRKITPIDEPLVMRGRVTRTEGRKAFVSAELVDGDEMLLAEGNGMMVRLLAGQP
Bibliography
No article yet recorded