Gene ML0314c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible lipase LipU |
| Comments | ML0314c, len: 335 aa. Possible lipU, lipase (EC 3.1.-.-), highly similar to Rv1076|O53424|AL123456 lipU, possible lipase from M. tuberculosis (297 aa), Fasta scores: E(): 0, (79.7% identity in 296 aa overlap); and to other putative lipases and esterases from M. tuberculosis. Also similar to other bacterial lipases and esterases e.g. BAH_STRHY|Q01109 bah, acetyl-hydrolase from Streptomyces hygroscopicus (299 aa), Fasta scores: E(): 6.6e-19, (36.2% identity in 246 aa overlap). Previuosly sequenced as Q9ZBM4|AL035159 (335 aa), Fasta scores: E(): 0, (99.7% identity in 335 aa overlap). Contains PS01174 Lipolytic enzymes 'G-D-X-G' family, putative serine active site. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 400772 | 401779 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0314c|lipU
LAISAGAPVEIVESGPSIAARLASLTSRLTIRPILAVGSYVPQLPWPFGLIDHAARVLLPVTNAARAEVNLSNTSAQLVRAAGVRPADGSGRIVLYLHGGAFLGCGANSHRRLVETLSKLADSPILVVNYRLLPKHSIGMALDDCHDGYQWLRRLGYDPEQIVLAGDSAGGYLALALAQRLQDVGEEPAALVAISPLLQLAKKGKQAHPNAKTDAMFPPKAFDALGRLVASSAAKNKVDDKPEELYEPLDHIAPGLPRTLIHVSGSEVLLHDAQLAATKLAAVGVPAEIRVWPGQVHVFQAAAPMVPEATLSLRQISQYIREATASKASRDRQSL
Bibliography
No article yet recorded
