Gene ML0319c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible lipoprotein LpqE |
| Comments | ML0319c, len: 183 aa. Possible lpqE, conserved lipoprotein, highly similar to Rv3584|O53569|AL123456 lpqE, conserved lipoprotein from M. tuberculosis (182 aa), Fasta scores: E(): 0, (63.4% identity in 175 aa overlap). Previously sequenced as Q9ZBM7|AL035159 (183 aa), Fasta scores: E(): 0, (99.5% identity in 183 aa overlap). Contains a probable N-terminal signal sequence. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 409443 | 409994 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0319c|lpqE
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNRVTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITSDIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPITNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
Bibliography
No article yet recorded