Gene ML0364 
in Mycobacterium leprae TN
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Probable 50S ribosomal protein L13 RplM | 
| Comments | ML0364, len: 147 aa. Probable rplM, 50S ribosomal protein L13, equivalent to Rv3443c|RL13_MYCTU|O06260 rplM, 50S ribosomal protein L13 from M. tuberculosis (147 aa), Fasta scores: E(): 0, (91.2% identity in 147 aa overlap). Also highly similar to others e.g. Q53874|RL13_STRCO|SC6G4.12 from Streptomyces coelicolor (147 aa). Previuosly sequenced as RL13_MYCLE|P38014 (147 aa), Fasta scores: E(): 0, (99.3% identity in 147 aa overlap). Contains Pfam match to entry PF00572 Ribosomal_L13, Ribosomal protein L13. Contains PS00783 Ribosomal protein L13 signature. Belongs to the L13P family of ribosomal proteins. | 
| Functional category | Information pathways | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 456985 | 457428 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium leprae TN|ML0364|rplM
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDGGDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRVVEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
      
    Bibliography
    No article yet recorded