Gene ML0364
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable 50S ribosomal protein L13 RplM |
| Comments | ML0364, len: 147 aa. Probable rplM, 50S ribosomal protein L13, equivalent to Rv3443c|RL13_MYCTU|O06260 rplM, 50S ribosomal protein L13 from M. tuberculosis (147 aa), Fasta scores: E(): 0, (91.2% identity in 147 aa overlap). Also highly similar to others e.g. Q53874|RL13_STRCO|SC6G4.12 from Streptomyces coelicolor (147 aa). Previuosly sequenced as RL13_MYCLE|P38014 (147 aa), Fasta scores: E(): 0, (99.3% identity in 147 aa overlap). Contains Pfam match to entry PF00572 Ribosomal_L13, Ribosomal protein L13. Contains PS00783 Ribosomal protein L13 signature. Belongs to the L13P family of ribosomal proteins. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 456985 | 457428 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0364|rplM
VPTYAPKAGDTTCSWYVIDATDVVLGRLAAVAATLLRGKHKPTFAPNVDGGDFVIVINADKVAISGDKVQHKMVYRHSGYPGGLRKRTIGELMQKHPDRVVEKAIVGMLPKNKLSRQIQRKLRVYAGPDHPHSAQQPVPFEIKQVAQ
Bibliography
No article yet recorded