Gene ML0380 (cpn10, mpt57)
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 10 kD chaperonin GroES (Protein Cpn10) (groES protein) (BCG-A heat shock protein) (10 kDa antigen) |
| Comments | ML0380, len: 100 aa. groES (alternate gene names: cpn10, mpt57), 10 kDa chaperonin (protein cpn10) (see citations below), equivalent to Rv3418c|CH10_MYCTU|P09621 groES, 10 kD chaperonin from M. tuberculosis (100 aa), Fasta scores: E(): 3.6e-32, (89.9% identity in 99 aa overlap). Also highly similar to others e.g. P15020|CH10_MYCBO|MOPB|GROES from Mycobacterium bovis (99 aa), and P40172|CH10_STRCO|GROES|SC6G4.39 from Streptomyces coelicolor and Streptomyces lividans (102 aa). Previously sequenced as CH10_MYCLE|P24301 (99 aa), Fasta scores: E(): 0, (100.0% identity in 99 aa overlap). Contains Pfam match to entry PF00166 cpn10, Chaperonins 10 Kd subunit. Contains PS00681 Chaperonins cpn10 signature. Belongs to the groES chaperonin family. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 473178 | 473480 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0380|groES
VAKVKIKPLEDKILVQAGEAETMTPSGLVIPENAKEKPQEGTVVAVGPGRWDEDGAKRIPVDVSEGDIVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
Bibliography
No article yet recorded
