Gene ML0386c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0386c, len: 137 aa. Conserved hypothetical protein, equivalent to Rv3412|YY12_MYCTU|Q50714 conserved hypothetical protein from M. tuberculosis (136 aa), Fasta scores: E(): 0, (93.4% identity in 136 aa overlap). Also similar to Q8NSR6 Hypothetical protein Cgl0602 from Corynebacterium glutamicum (126 aa), Fasta scores: E(): 0, (42.2% identity in 116 aa overlap). Previously sequenced as YY12_MYCLE|Q49742 (137 aa), Fasta scores: E(): 0, (99.3% identity in 137 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 480094 | 480507 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0386c|ML0386c
VRDHLPPGLPPDPFADDPCDPSAALDAVEPGQPLDQQERIAVEADLADLAVYEALLAHKGIRGLVVCCDECQQDHYHDWDMLRANLLQLLIDGTVRPHEPAYDPEPDSYVTWDYCRGYADASLNQATSDADGYRRRH
Bibliography
No article yet recorded