Gene ML0418
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible oxidoreductase |
| Comments | ML0418, len: 210 aa. Possible oxidoreductase (EC 1.-.-.-), highly similar to Rv3368c|O50397|AL123456 possible oxidoreductase from M. tuberculosis (214 aa), Fasta scores: E(): 0, (81.9% identity in 210 aa overlap). Shows weak similarity NOX_THETH|X60110) nox, NADH dehydrogenase from Thermus aquaticus (205 aa), Fasta scores: E(): 0.00023, (28.8% identity in 212 aa overlap); and O30106|AF0131 putative NAD(P)H-flavin oxidoreductase from Archaeoglobus fulgidus (194 aa). Previously sequenced as O07697|Z97179 (210 aa), Fasta scores: E(): 0, (99.5% identity in 210 aa overlap). Also similar to ML2006 a possible pseudogene similar to M. tuberculosis Rv3368c. Contains Pfam match to entry PF00881 Nitroreductase, Nitroreductase family. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp sign. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 517645 | 518277 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0418|ML0418
LSVDEVLTTTRSVRKRLDFDKPVPRDVLMECLQLALQAPTGSNSQGWHWVFVEDAEKRKAIGDIYLVNARCYLSQPAPEYPEGDTRGERMRLVRDSATYLAEHMHEVPVLLIPCLLGRAEESPLGAVSYWASLFPAVWSFCLALRSRGLGTCWTSLHLLGDGEQRAAEVLGIPSDKYSQGGLFPIAYTKGTDFRPANRLPAENVTHWDIW
Bibliography
No article yet recorded
