Gene ML0425
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved membrane protein |
| Comments | ML0425, len: 75 aa. Possible conserved membrane protein, similar to Rv2520c|O53225|AL123456 possible conserved membrane protein from M. tuberculosis (75 aa), Fasta scores: E(): 2.2e-15, (57.3% identity in 75 aa overlap). Previously sequenced as O07706|Z97179) (91 aa), Fasta scores: E(): 7.9e-29, (100.0% identity in 75 aa overlap). Contains hydrophobic, possible membrane-spanning region. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 524417 | 524644 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0425|ML0425
VADRHPDTIKLEIDVAREQFAATVDSLAERANPRRLAGDLKARVVEFGRRPAVIAALVSCAVLTVIVVVRKVKNR
Bibliography
No article yet recorded