Gene ML0431c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved proline rich membrane protein |
| Comments | ML0431c, len: 259 aa. Possible conserved pro-rich membrane protein, highly Similar to Rv2507|O06170|AL123456 membrane protein from M. tuberculosis (273 aa), Fasta scores: E(): 0, (60.4% identity in 275 aa overlap). Previously sequenced as O07711|Z97179 (261 aa), Fasta scores: E(): 0, (100.0% identity in 259 aa overlap). Contains hydrophobic, possible membrane-spanning regions. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 530917 | 531696 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0431c|ML0431c
MNNPRRSEWLGPSLAGSGPIEPQVHQYPPLTDPAYAEQAPYAPAYGASLPPWTPKKPPQQLPRYWQQDQPPPTDIPPEGLTLPPPHEPKSPHWFLWVVAGASVVLVVGLVMALIIANGAIKTQTAVPPLPAITESSSATPTPTTKTSPTPTAGPAPSTTGSGTLTQTIGPSAMLDVVYSITGQGRAISVTYMDTGDVIQTEFNVVLPWSKQVSLSKSAVHPASVTIVNIGHDVTCSVTVAGVQIRQHTGVGLTICDAPR
Bibliography
No article yet recorded